General Information

  • ID:  hor002034
  • Uniprot ID:  Q95336
  • Protein name:  Progonadoliberin-2
  • Gene name:  GNRH2
  • Organism:  Tupaia belangeri (Common tree shrew) (Tupaia glis belangeri)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Midbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Tupaia (genus), Tupaiidae (family), Scandentia (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRASNSPQDPQSALRPPAPSAAQTAHSFRSAALASPEDSVPWEGRTTAGWSLRRKQHLMRTLLSAAGAPRPAAVPIKP
  • Length:  89
  • Propeptide:  MASSMLGFLLLLLLLMAAHPGPSEAQHWSHGWYPGGKRASNSPQDPQSALRPPAPSAAQTAHSFRSAALASPEDSVPWEGRTTAGWSLRRKQHLMRTLLSAAGAPRPAAVPIKP
  • Signal peptide:  MASSMLGFLLLLLLLMAAHPGPSEA
  • Modification:  T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95336-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002034_AF2.pdbhor002034_ESM.pdb

Physical Information

Mass: 1112652 Formula: C422H654N134O120S
Absent amino acids: C Common amino acids: A
pI: 12.07 Basic residues: 15
Polar residues: 23 Hydrophobic residues: 29
Hydrophobicity: -74.38 Boman Index: -17791
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.04
Instability Index: 7841.24 Extinction Coefficient cystines: 23490
Absorbance 280nm: 266.93

Literature

  • PubMed ID:  NA
  • Title:  NA